PDB entry 1hct

View 1hct on RCSB PDB site
Description: nmr structure of the human src sh2 domain complex
Deposited on 1994-09-02, released 1995-09-15
The last revision prior to the SCOP 1.57 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.57: d1hctb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hctB (B:)
    mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
    khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp