PDB entry 1hcs

View 1hcs on RCSB PDB site
Description: nmr structure of the human src sh2 domain complex
Deposited on 1994-09-02, released 1995-09-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.55: d1hcsb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hcsB (B:)
mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp