PDB entry 1hcp

View 1hcp on RCSB PDB site
Description: dna recognition by the oestrogen receptor: from solution to the crystal
Deposited on 1993-11-23, released 1995-11-23
The last revision prior to the SCOP 1.65 freeze date was dated 1995-11-23, with a file datestamp of 1995-11-28.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1hcp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1hcp_ (-)
mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
acrlrkcyevgmmkgg

    Sequence, based on observed residues (ATOM records): (download) 
    >1hcp_ (-)
mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
acrlrkcyevgmmkg