PDB entry 1hcf

View 1hcf on RCSB PDB site
Description: crystal structure of trkb-d5 bound to neurotrophin-4/5
Class: transferase/hormone
Keywords: transferase/hormone, complex(transferase/growth factor), neurotrophin-4/5, trkb receptor, ngf-beta superfamily, immunoglobulin domain
Deposited on 2001-05-03, released 2001-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neurotrophin-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hcfa_
  • Chain 'B':
    Compound: neurotrophin-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hcfb_
  • Chain 'X':
    Compound: bdnf/nt-3 growth factors receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HCF (0-2)
    • Uniprot Q16620 (3-100)
    Domains in SCOPe 2.06: d1hcfx_
  • Chain 'Y':
    Compound: bdnf/nt-3 growth factors receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HCF (0-2)
    • Uniprot Q16620 (3-100)
    Domains in SCOPe 2.06: d1hcfy_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hcfA (A:)
    gvsetapasrrgelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetr
    ckadnaeeggpgaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacv
    ctllsrtgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcfA (A:)
    gvsetapasrrgelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetr
    ckadpgaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsr
    t
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hcfB (B:)
    gvsetapasrrgelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetr
    ckadnaeeggpgaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacv
    ctllsrtgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcfB (B:)
    tapasrrgelavcdavsgwvtdrrtavdlrgrevevlgevpaasplrqyffetrckadae
    eggpgaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrt
    g
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hcfX (X:)
    shmaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
    hgclqldnpthmnngdytliakneygkdekqisahfmgwpg
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hcfY (Y:)
    shmaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
    hgclqldnpthmnngdytliakneygkdekqisahfmgwpg