PDB entry 1hce

View 1hce on RCSB PDB site
Description: structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor
Class: actin binding
Keywords: actin binding
Deposited on 1994-07-12, released 1994-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hisactophilin
  Species: Dictyostelium discoideum [TaxId:44689]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13231 (1-117)
  Domains in SCOPe 2.08: d1hcea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hceA (A:)
  mgnrafkshhghflsaegeavkthhghhdhhthfhvenhggkvalkthcgkylsigdhkq
  vylshhlhgdhslfhlehhggkvsikghhhhyisadhhghvstkehhdhdttfeeiii