PDB entry 1hcc

View 1hcc on RCSB PDB site
Description: three-dimensional structure of a complement control protein module in solution
Class: glycoprotein
Keywords: glycoprotein
Deposited on 1990-11-28, released 1992-04-15
The last revision prior to the SCOP 1.73 freeze date was dated 1992-04-15, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 16th complement control protein
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08603 (0-58)
  Domains in SCOP 1.73: d1hcca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hccA (A:)
  eglpcksppeishgvvahmsdsyqygeevtykcfegfgidgpaiakclgekwshppsci