PDB entry 1hcc

View 1hcc on RCSB PDB site
Description: three-dimensional structure of a complement control protein module in solution
Class: glycoprotein
Keywords: glycoprotein
Deposited on 1990-11-28, released 1992-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 16th complement control protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08603 (0-58)
  Domains in SCOPe 2.08: d1hcca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hccA (A:)
  eglpcksppeishgvvahmsdsyqygeevtykcfegfgidgpaiakclgekwshppsci