PDB entry 1hcb

View 1hcb on RCSB PDB site
Description: enzyme-substrate interactions: structure of human carbonic anhydrase i complexed with bicarbonate
Deposited on 1994-01-07, released 1994-04-30
The last revision prior to the SCOP 1.69 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.177
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1hcb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1hcb_ (-)
    aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
    nvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
    ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
    pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
    mqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcb_ (-)
    pdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinv
    ghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvah
    wnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdps
    tllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmq
    hnnrptqplkgrtvrasf