PDB entry 1hc8

View 1hc8 on RCSB PDB site
Description: crystal structure of a conserved ribosomal protein-RNA complex
Class: ribosome
Keywords: ribosome, ribosomal RNA, tertiary structure, RNA-protein
Deposited on 2001-04-27, released 2002-05-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein l11
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hc8a_
  • Chain 'B':
    Compound: ribosomal protein l11
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hc8b_
  • Chain 'C':
    Compound: 58 nucleotide ribosomal 23s RNA domain
    Species: Escherichia coli [TaxId:562]
    Gene:
  • Chain 'D':
    Compound: 58 nucleotide ribosomal 23s RNA domain
    Species: Escherichia coli [TaxId:562]
    Gene:
  • Heterogens: MG, K, OS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hc8A (A:)
    ftfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
    rmiegtarsmgivven
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hc8A (A:)
    tfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaamr
    miegtarsmgivve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hc8B (B:)
    ftfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
    rmiegtarsmgivven
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hc8B (B:)
    ktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaamrmieg
    tarsmgivve
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.