PDB entry 1hby

View 1hby on RCSB PDB site
Description: Binding of Phosphate and Pyrophosphate ions at the active site of human angiogenin as revealed by X-ray Crystallography
Class: angiogenin
Keywords: angiogenin, ribonuclease, phosphate, pyrophosphate
Deposited on 2001-04-21, released 2001-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: angiogenin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03950 (0-122)
    • modified residue (0)
  Domains in SCOPe 2.08: d1hbya_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hbyA (A:)
  ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
  ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
  rrp