PDB entry 1hbh

View 1hbh on RCSB PDB site
Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect
Class: oxygen carrier
Keywords: oxygen carrier
Deposited on 1995-02-22, released 1995-04-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.16
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (deoxy) (alpha chain)
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hbha_
  • Chain 'B':
    Compound: hemoglobin (deoxy) (beta chain)
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hbhb_
  • Chain 'C':
    Compound: hemoglobin (deoxy) (alpha chain)
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hbhc_
  • Chain 'D':
    Compound: hemoglobin (deoxy) (beta chain)
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hbhd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbhA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbhB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbhC (C:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbhD (D:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh