PDB entry 1hbg

View 1hbg on RCSB PDB site
Description: glycera dibranchiata hemoglobin. structure and refinement at 1.5 angstroms resolution
Deposited on 1991-02-11, released 1992-07-15
The last revision prior to the SCOP 1.71 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.146
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1hbg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbg_ (-)
    glsaaqrqviaatwkdiagadngagvgkkclikflsahpqmaavfgfsgasdpgvaalga
    kvlaqigvavshlgdegkmvaqmkavgvrhkgygnkhikaqyfeplgasllsamehrigg
    kmnaaakdawaaayadisgalisglqs