PDB entry 1hb3

View 1hb3 on RCSB PDB site
Description: isopenicillin n synthase from aspergillus nidulans (oxygen exposed product from anaerobic acov fe complex)
Deposited on 2001-04-11, released 2001-11-23
The last revision prior to the SCOP 1.69 freeze date was dated 2002-01-17, with a file datestamp of 2002-01-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.182
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1hb3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hb3A (A:)
    mgsvskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktke
    fhmsitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqak
    tpthevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddt
    lasvvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyq
    dieaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdpr
    epngksdreplsygdylqnglvslinkngqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hb3A (A:)
    svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
    msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
    thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
    svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
    eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
    ngksdreplsygdylqnglvslinkngqt