PDB entry 1hb0

View 1hb0 on RCSB PDB site
Description: snapshots of serine protease catalysis: (d) acyl-enzyme intermediate between porcine pancreatic elastase and human beta-casomorphin-7 jumped to ph 10 for 2 minutes
Class: hydrolase
Keywords: serine proteinase, hydrolase (serine proteinase)
Deposited on 2001-04-10, released 2001-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-07, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: Elastase 1
  Species: SUS SCROFA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00772 (0-239)
  Domains in SCOP 1.73: d1hb0b_
• Heterogens: CA, SO4, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hb0B (B:)
  vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
  nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
  lrnnspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
  rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn