PDB entry 1haz

View 1haz on RCSB PDB site
Description: snapshots of serine protease catalysis: (c) acyl-enzyme intermediate between porcine pancreatic elastase and human beta-casomorphin-7 jumped to ph 9 for 1 minute
Class: serine proteinase
Keywords: serine proteinase, hydrolase (serine proteinase)
Deposited on 2001-04-10, released 2001-08-02
The last revision prior to the SCOP 1.75 freeze date was dated 2001-08-02, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.199
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-casomorphin-7
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 1HAZ (0-3)
  • Chain 'B':
    Compound: Elastase 1
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hazb_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hazB (B:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn