PDB entry 1hau

View 1hau on RCSB PDB site
Description: x-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
Class: oxidoreductase
Keywords: nitrite reductase, blue copper, oxidoreductase oxidoreductase, oxidoreductase
Deposited on 2001-04-09, released 2001-08-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXYDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1haua1, d1haua2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hauA (A:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr