PDB entry 1hau

View 1hau on RCSB PDB site
Description: x-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9a resolution
Class: reductase
Keywords: nitrite reductase, copper, blue copper, oxidoreductase
Deposited on 2001-04-09, released 2001-08-02
The last revision prior to the SCOP 1.75 freeze date was dated 2001-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: Alcaligenes xylosoxydans xylosoxydans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1haua1, d1haua2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hauA (A:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr