PDB entry 1har

View 1har on RCSB PDB site
Description:
Deposited on 1994-10-28, released 1995-04-20
The last revision prior to the SCOP 1.65 freeze date was dated 1995-04-20, with a file datestamp of 1995-04-27.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1har__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1har_ (-)
    pispietvpvklkpgmdgpkvaqwpltaakiaalvaictemekegkiskigpenpyntpv
    faikkkdstkwaklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilapfkaanpdivi
    yqymddlyvgsdlaigahrtkieelrqhllrwgltt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1har_ (-)
    pispietvpvklkpgmdgpkvaqwpltaakiaalvaictemekegkiskigpenpyntpv
    faiwaklvdfrelnkrtqdfwevksvtvldvgdayfsvpldedfrkytaftipsinnetp
    giryqynvlpqgwkgspaifqssmtkilapfkaanpdiviyqymddlyvgsdlaigahrt
    kieelrqhllrwgltt