PDB entry 1hak

View 1hak on RCSB PDB site
Description: crystal structure of recombinant human placental annexin v complexed with k-201 as a calcium channel activity inhibitor
Deposited on 1997-12-10, released 1999-02-16
The last revision prior to the SCOP 1.57 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.206
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1haka_
  • Chain 'B':
    Domains in SCOP 1.57: d1hakb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hakA (A:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcgedd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hakB (B:)
    qvlrgtvtdfpgfderadaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfg
    rdllddlkseltgkfeklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeel
    raikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqa
    gelkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvk
    sirsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikg
    dtsgdykkallllcgedd