PDB entry 1hag

View 1hag on RCSB PDB site
Description: the isomorphous structures of prethrombin2, hirugen-and ppack-thrombin: changes accompanying activation and exosite binding to thrombin
Class: hydrolase/hydrolase inhibitor
Keywords: complex(serine proteinase-inhibitor), hydrolase-hydrolase inhibitor complex
Deposited on 1994-06-27, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: prethrombin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hage_
  • Chain 'I':
    Compound: hirugen
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hagE (E:)
tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq
ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki
yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd
sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

  • Chain 'I':
    No sequence available.