PDB entry 1ha6

View 1ha6 on RCSB PDB site
Description: nmr solution structure of murine ccl20/mip-3a chemokine
Deposited on 2001-03-28, released 2001-08-22
The last revision prior to the SCOP 1.59 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ha6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha6A (A:)
    asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkrav
    nllslrvkkm