PDB entry 1ha5

View 1ha5 on RCSB PDB site
Description: structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
Deposited on 2001-03-28, released 2002-04-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.214
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha5A (A:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhagnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha5B (B:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhagnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha5C (C:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhagnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha5D (D:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhagnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt