PDB entry 1ha4

View 1ha4 on RCSB PDB site
Description: gammas crystallin c terminal domain from homo sapiens
Class: eye lens protein
Keywords: eye lens protein, gammas crystallin
Deposited on 2001-03-27, released 2001-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2159
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gamma crystallin s
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22914 (0-86)
  Domains in SCOPe 2.08: d1ha4a_
• Chain 'B':
  Compound: gamma crystallin s
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22914 (0-86)
  Domains in SCOPe 2.08: d1ha4b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ha4A (A:)
  gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
  ldkkeyrkpidwgaaspavqsfrrive
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ha4B (B:)
  gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
  ldkkeyrkpidwgaaspavqsfrrive