PDB entry 1ha1

View 1ha1 on RCSB PDB site
Description: hnrnp a1 (rbd1,2) from homo sapiens
Class: nuclear protein
Keywords: nuclear protein, hnrnp, rbd, rrm, rnp, RNA binding, ribonucleoprotein
Deposited on 1996-10-30, released 1997-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hnrnp a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ha1a1, d1ha1a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ha1A (A:)
    msksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfv
    tyatveevdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehh
    lrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrka
    lskq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ha1A (A:)
    epeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatveev
    daamnarphkvdgrvvepkravsreahltvkkifvggikedteehhlrdyfeqygkievi
    eimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkal