PDB entry 1ha0

View 1ha0 on RCSB PDB site
Description: hemagglutinin precursor ha0
Deposited on 1998-10-08, released 1998-10-12
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha0A (A:)
    statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpekqtqglfgaiagfiengwegmidgwygfrhqnsegtgqaadlk
    stqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaell
    valenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesirngtydh
    dvyrnealnnrfqi