PDB entry 1h9x

View 1h9x on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, reduced form
Class: oxidoreductase
Keywords: enzyme, nitrite reductase, oxidoreductase
Deposited on 2001-03-23, released 2001-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome cd1 nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h9xa1, d1h9xa2
  • Chain 'B':
    Compound: cytochrome cd1 nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h9xb1, d1h9xb2
  • Heterogens: HEC, DHE, NHE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h9xA (A:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgatyeiksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9xA (A:)
    apegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylqsfityg
    spagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemreswkvhvapedrptqqen
    dwdlenlfsvtlrdagqialidgatyeiksvldtgyavhisrlsasgrylfvigrdgkvn
    midlwmkepttvaeikigsearsietskmegwedkyaiagaywppqyvimdgetlepkki
    qstrgmtydeqeyhpeprvaailashyrpefivnvketgkillvdytdldnlktteisae
    rflhdggldgshryfitaanarnklvvidtkegklvaiedtggqtphpgrganfvhptfg
    pvwatshmgddsvaligtdpeghpdnawkildsfpalgggslfikthpnsqylyvdatln
    peaeisgsvavfdikamtgdgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsv
    wngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmtdty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h9xB (B:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgatyeiksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9xB (B:)
    apgapegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylqsfi
    tygspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemreswkvhvapedrptq
    qendwdlenlfsvtlrdagqialidgatyeiksvldtgyavhisrlsasgrylfvigrdg
    kvnmidlwmkepttvaeikigsearsietskmegwedkyaiagaywppqyvimdgetlep
    kkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkillvdytdldnlkttei
    saerflhdggldgshryfitaanarnklvvidtkegklvaiedtggqtphpgrganfvhp
    tfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslfikthpnsqylyvda
    tlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqprvvqgefnkdgtevw
    fsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmtdty