PDB entry 1h9w

View 1h9w on RCSB PDB site
Description: native dioclea guianensis seed lectin
Deposited on 2001-03-22, released 2001-03-23
The last revision prior to the SCOP 1.67 freeze date was dated 2001-08-16, with a file datestamp of 2001-08-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1h9wa_
  • Chain 'B':
    Domains in SCOP 1.67: d1h9wb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h9wA (A:)
    adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
    lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
    adanslhfsfnqfsqnpkdlilqgdattdsdgnleltkvsssgdpqgssvgralfyapvh
    iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9wA (A:)
    adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
    lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktans
    lhfsfnqfsqnpkdlilqgdattdsdgnleltkvsssgdpqgssvgralfyapvhiweks
    avvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h9wB (B:)
    adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
    lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
    adanslhfsfnqfsqnpkdlilqgdattdsdgnleltkvsssgdpqgssvgralfyapvh
    iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9wB (B:)
    adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
    lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklkansl
    hfsfnqfsqnpkdlilqgdattdsdgnleltkvsssgdpqgssvgralfyapvhiweksa
    vvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpda