PDB entry 1h9v

View 1h9v on RCSB PDB site
Description: human fc-gamma-receptor iia (fcgriia), monoclinic
Deposited on 2001-03-21, released 2001-06-21
The last revision prior to the SCOP 1.65 freeze date was dated 2001-06-21, with a file datestamp of 2001-06-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h9vA (A:)
appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvlsewlvlqtphlefqegetimlrchswkdkplvkvtf
fqngksqkfsrldptfsipqanhshsgdyhctgnigytlfsskpvtitvqvp