PDB entry 1h9u

View 1h9u on RCSB PDB site
Description: the structure of the human retinoid-x-receptor beta ligand binding domain in complex with the specific synthetic agonist lg100268
Class: nuclear receptor
Keywords: nuclear receptor, rxr, transcription factor
Deposited on 2001-03-21, released 2002-04-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.273
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinoid x receptor, beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1h9ua_
  • Chain 'B':
    Compound: retinoid x receptor, beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1h9ub_
  • Chain 'C':
    Compound: retinoid x receptor, beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1h9uc_
  • Chain 'D':
    Compound: retinoid x receptor, beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1h9ud_
  • Heterogens: LG2, NI, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h9uA (A:)
    mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
    hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
    rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
    ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9uA (A:)
    mpvdrileaelavpvtnicqaadkqlftlvewakriphfsslplddqvillragwnelli
    asfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgcl
    raiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsigl
    kclehlfffkligdtpidtfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h9uB (B:)
    mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
    hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
    rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
    ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9uB (B:)
    mpvdrileaelavpvtnicqaadkqlftlvewakriphfsslplddqvillragwnelli
    asfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgcl
    raiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsigl
    kclehlfffkligdtpidtfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h9uC (C:)
    mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
    hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
    rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
    ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9uC (C:)
    mpvdrileaelavpvtnicqaadkqlftlvewakriphfsslplddqvillragwnelli
    asfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgcl
    raiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsigl
    kclehlfffkligdtpidtfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h9uD (D:)
    mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
    hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
    rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
    ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9uD (D:)
    mpvdrileaelavpvtnicqaadkqlftlvewakriphfsslplddqvillragwnelli
    asfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgcl
    raiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsigl
    kclehlfffkligdtpidtfl