PDB entry 1h9t

View 1h9t on RCSB PDB site
Description: fadr, fatty acid responsive transcription factor from e. coli in complex with fadb operator
Class: transcriptional regulation
Keywords: transcriptional regulation
Deposited on 2001-03-19, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.265
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid metabolism regulator protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H9T (Start-22)
    • Uniprot P09371 (Start-242)
    Domains in SCOPe 2.07: d1h9ta1, d1h9ta2
  • Chain 'B':
    Compound: fatty acid metabolism regulator protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H9T (Start-22)
    • Uniprot P09371
    Domains in SCOPe 2.07: d1h9tb1, d1h9tb2
  • Chain 'X':
    Compound: 5'-d(*cp*ap*tp*cp*tp*gp*gp*tp*ap*cp*gp*ap* cp*cp*ap*gp*ap*tp*c)-3'
  • Chain 'Y':
    Compound: 5'-d(*gp*ap*tp*cp*tp*gp*gp*tp*cp*gp*tp*ap* cp*cp*ap*gp*ap*tp*g)-3'
  • Heterogens: AU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h9tA (A:)
    fadrmvikaqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrla
    rdgwltiqhgkptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirta
    frqhpdkaqevlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrig
    rhyfanpearslalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqknlpgdlai
    qgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9tA (A:)
    aqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiq
    hgkptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirtafrqhpdka
    qevlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpe
    arslalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqknllaiqgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h9tB (B:)
    fadrmvikaqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrla
    rdgwltiqhgkptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirta
    frqhpdkaqevlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrig
    rhyfanpearslalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqknlpgdlai
    qgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9tB (B:)
    aqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiq
    hgkptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirtafrqhpdka
    qevlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpe
    arslalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqknl
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.