PDB entry 1h9p

View 1h9p on RCSB PDB site
Description: crystal structure of dioclea guianensis seed lectin
Class: lectin
Keywords: lectin, legume lectin oligomerisation
Deposited on 2001-03-16, released 2001-03-23
The last revision prior to the SCOP 1.73 freeze date was dated 2001-11-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.239
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lectin
    Species: Dioclea guianensis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81637 (0-236)
      • conflict (189)
    Domains in SCOP 1.73: d1h9pa_
  • Heterogens: CD, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h9pA (A:)
    adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
    lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
    adanslhfsfnqfsqnpkdlilqsdattdsdgnleltkvsssgdpqgssvgralfyapvh
    iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9pA (A:)
    adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
    lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktdan
    slhfsfnqfsqnpkdlilqsdattdsdgnleltkvsssgdpqgssvgralfyapvhiwek
    savvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan