PDB entry 1h9l

View 1h9l on RCSB PDB site
Description: porcine pancreatic elastase complexed with acetyl-val-glu-pro-ile-cooh
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, hydrolase, hydrolase-hydrolase inhibitor complex
Deposited on 2001-03-13, released 2001-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.159
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1H9L (Start-3)
  • Chain 'B':
    Compound: elastase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h9lb_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h9lB (B:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn