PDB entry 1h9f

View 1h9f on RCSB PDB site
Description: lem domain of human inner nuclear membrane protein lap2
Class: membrane protein
Keywords: membrane protein, inner nuclear membrane protein, lamina-associated polypeptide, emerin, lem domain
Deposited on 2001-03-09, released 2001-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymopoietin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h9fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h9fA (A:)
    rqedkddldvteltnedlldqlvkygvnpgpivgttrklyekkllklreqgtesrss