PDB entry 1h9b

View 1h9b on RCSB PDB site
Description: active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Class: oxidoreductase
Keywords: oxidoreductase, glucose metabolism
Deposited on 2001-03-06, released 2001-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose 6-phosphate 1-dehydrogenase
    Species: LEUCONOSTOC MESENTEROIDES [TaxId:1245]
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11411 (0-484)
      • engineered mutation (364)
    Domains in SCOPe 2.07: d1h9ba1, d1h9ba2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h9bA (A:)
    vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
    sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
    rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
    gkemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnh
    tmqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpy
    leeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgs
    eqeaceavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpepyermih
    dtmngdgsnfadwngvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangda
    wvfkg