PDB entry 1h96

View 1h96 on RCSB PDB site
Description: recombinant mouse l-chain ferritin
Deposited on 2001-02-28, released 2001-03-06
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-06, with a file datestamp of 2001-03-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1h96a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h96A (A:)
    tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre
    gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar
    adphlcdfleshyldkevklikkmgnhltnlrrvagpqpaqtgapqgslgeylferltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h96A (A:)
    tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre
    gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar
    adphlcdfleshyldkevklikkmgnhltnlrrvagslgeylferltlk