PDB entry 1h95

View 1h95 on RCSB PDB site
Description: solution structure of the single-stranded DNA-binding cold shock domain (csd) of human y-box protein 1 (yb1) determined by nmr (10 lowest energy structures)
Class: translation factor
Keywords: translation factor, transcription factor, ob-fold, 5-stranded anti-parallel beta-barrel, single stranded DNA binding, cold shock, y-box
Deposited on 2001-02-23, released 2002-02-21
The last revision prior to the SCOP 1.75 freeze date was dated 2002-02-21, with a file datestamp of 2007-07-20.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: y-box binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1h95a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h95A (A:)
    mkkviatkvlgtvkwfnvrngygfinrndtkedvfvhqtaikknnprkylrsvgdgetve
    fdvvegekgaeaanvtgpg