PDB entry 1h95

View 1h95 on RCSB PDB site
Description: solution structure of the single-stranded dna-binding cold shock domain (csd) of human y-box protein 1 (yb1) determined by nmr (10 lowest energy structures)
Deposited on 2001-02-23, released 2002-02-21
The last revision prior to the SCOP 1.71 freeze date was dated 2002-02-21, with a file datestamp of 2002-02-21.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h95a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h95A (A:)
    mkkviatkvlgtvkwfnvrngygfinrndtkedvfvhqtaikknnprkylrsvgdgetve
    fdvvegekgaeaanvtgpg