PDB entry 1h94

View 1h94 on RCSB PDB site
Description: complex of active mutant (s215->c) of glucose 6-phosphate dehydrogenase from l.mesenteroides with coenzyme nad
Class: oxidoreductase (choh(d) - nad(p))
Keywords: oxidoreductase (choh(d) - nad(p)), glucose metabolism
Deposited on 2001-02-23, released 2001-05-03
The last revision prior to the SCOP 1.75 freeze date was dated 2001-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose 6-phosphate 1-dehydrogenase
    Species: Leuconostoc mesenteroides
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11411 (0-484)
      • engineered mutation (214)
    Domains in SCOP 1.75: d1h94a1, d1h94a2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h94A (A:)
    vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
    sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
    rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
    gkemvqniaalrfgnpifdaawnkdyiknvqvtlcevlgveeragyydtagalldmiqnh
    tmqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpy
    leeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgs
    eqeaqeavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpepyermih
    dtmngdgsnfadwngvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangda
    wvfkg