PDB entry 1h92

View 1h92 on RCSB PDB site
Description: sh3 domain of human lck tyrosine kinase
Deposited on 2001-02-22, released 2001-10-22
The last revision prior to the SCOP 1.67 freeze date was dated 2001-10-22, with a file datestamp of 2001-10-22.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1h92a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h92A (A:)
    gsplqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfva
    kan