PDB entry 1h8n

View 1h8n on RCSB PDB site
Description: three-dimensional structure of anti-ampicillin single chain fv fragment from phage-displayed murine antibody libraries
Class: antibody
Keywords: antibody, framework
Deposited on 2001-02-14, released 2001-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.233
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mutant al2 6e7s9g
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H8N
    Domains in SCOPe 2.07: d1h8na1, d1h8na2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h8nA (A:)
    dykdivltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtg
    vpdrftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrggggsgggg
    sggggsggggsqvqlqesggelvrpgasvklsckasgytftsywinwvkqrpgqglewig
    niypsdsytnynqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvt
    vsaasgahhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h8nA (A:)
    kdivltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvp
    drftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelqvqlqesggelvr
    pgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytnynqkfkdkatltvd
    kssstaymqlssltsedsavyfcarwgywgqgtlvtvsa