PDB entry 1h8k

View 1h8k on RCSB PDB site
Description: a-spectrin sh3 domain a11v, v23l, m25v, v53i, v58l mutant
Deposited on 2001-02-09, released 2002-05-23
The last revision prior to the SCOP 1.69 freeze date was dated 2002-05-23, with a file datestamp of 2002-05-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1h8ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h8kA (A:)
    mdetgkelvlvlydyqeksprevtvkkgdiltllnstnkdwwkvevddrqgfipaaylkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h8kA (A:)
    kelvlvlydyqeksprevtvkkgdiltllnstnkdwwkvevddrqgfipaaylkkld