PDB entry 1h8d

View 1h8d on RCSB PDB site
Description: x-ray structure of the human alpha-thrombin complex with a tripeptide phosphonate inhibitor.
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, hydrolase-hydrolase inhibitor complex
Deposited on 2001-02-01, released 2001-02-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.17
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: thrombin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00734 (147-251)
  • PDB 1H8D (252-259)
  Domains in SCOPe 2.04: d1h8d.1
• Chain 'I':
  Compound: hirudin I
  Species: Hirudo medicinalis [TaxId:6421]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01050 (0-9)
• Chain 'L':
  Compound: thrombin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00734 (3-16)
  Domains in SCOPe 2.04: d1h8d.1
• Heterogens: PHW, HOH

PDB Chain Sequences:

• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h8dH (H:)
  ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
  vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
  pdretaasllqagykgrvtgwgnlketgqpsvlqvvnlpiverpvckdstriritdnmfc
  agykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlk
  kwiqkvidqfgcssvlivvc
  

  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h8dL (L:)
  eadcglrplfekksledkterellesyis