PDB entry 1h8c

View 1h8c on RCSB PDB site
Description: ubx domain from human faf1
Class: apoptosis
Keywords: apoptosis, faf1 ubx domain ubiquitin-like
Deposited on 2001-02-01, released 2001-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fas-associated factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h8ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h8cA (A:)
    naepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqld
    pnksllevklfpqetlfleake