PDB entry 1h8b

View 1h8b on RCSB PDB site
Description: ef-hands 3,4 from alpha-actinin / z-repeat 7 from titin
Class: structural protein
Keywords: structural protein, z-disk structural complex
Deposited on 2001-02-01, released 2001-08-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-actinin 2, skeletal muscle isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H8B
      • engineered mutation (2)
    • Uniprot P35609 (2-74)
    Domains in SCOPe 2.05: d1h8ba_
  • Chain 'B':
    Compound: titin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h8bA (A:)
    gamadtdtaeqviasfrilasdkpyilaeelrrelppdqaqycikrmpaysgpgsvpgal
    dyaafssalygesdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h8bA (A:)
    madtdtaeqviasfrilasdkpyilaeelrrelppdqaqycikrmpaysgpgsvpgaldy
    aafssalygesdl
    

  • Chain 'B':
    No sequence available.