PDB entry 1h8b

View 1h8b on RCSB PDB site
Description: ef-hands 3,4 from alpha-actinin / z-repeat 7 from titin
Class: z-disk structural complex
Keywords: z-disk structural complex
Deposited on 2001-02-01, released 2001-08-30
The last revision prior to the SCOP 1.73 freeze date was dated 2001-11-27, with a file datestamp of 2007-07-20.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-actinin 2, skeletal muscle isoform
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35609 (2-74)
      • engineered mutation (2)
    Domains in SCOP 1.73: d1h8ba_
  • Chain 'B':
    Compound: titin
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h8bA (A:)
    gamadtdtaeqviasfrilasdkpyilaeelrrelppdqaqycikrmpaysgpgsvpgal
    dyaafssalygesdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h8bA (A:)
    madtdtaeqviasfrilasdkpyilaeelrrelppdqaqycikrmpaysgpgsvpgaldy
    aafssalygesdl
    

  • Chain 'B':
    No sequence available.