PDB entry 1h7u

View 1h7u on RCSB PDB site
Description: nhpms2-atpgs
Deposited on 2001-07-10, released 2001-11-27
The last revision prior to the SCOP 1.63 freeze date was dated 2001-11-27, with a file datestamp of 2001-11-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.237
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h7uA (A:)
    vvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlkhhts
    kiqefadltqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqktpyp
    rprgttvsvqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgk
    rqpvvctggspsikenigsvfgqkqlqslipfvqlppsdsvceeyglscsdalhnlfyis
    gfisqcthgvgrsstdrqfffinrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdse
    cvdinvtpdkrqillqeeklllavlktsligmfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h7uA (A:)
    vvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlkgeal
    sslcalsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhk
    efqrnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigsvf
    gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
    inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinqillqeeklllavlkt
    sligmfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h7uB (B:)
    vlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlkhhtsk
    iqefadltqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqktpypr
    prgttvsvqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgkr
    qpvvctggspsikenigsvfgqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisg
    fisqcthgvgrsstdrqfffinrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsec
    vdinvtpdkrqillqeeklllavlktsligmfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h7uB (B:)
    vlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlealssl
    calsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhkefq
    rnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigsvfgqk
    qlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfffinr
    rpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdillqeeklllavlktsligmf
    d