PDB entry 1h7t

View 1h7t on RCSB PDB site
Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, here complex with cmp-neuac, cmp-neuac complex
Class: transferase
Keywords: nucleotidyltransferase, cmp-kdo synthetase, nucleoside monophosphate glycosides, lipopolysaccharide biosynthesis, sugar-activating enzymes, transferase
Deposited on 2001-07-10, released 2001-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.173
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: KPSU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h7ta_
  • Chain 'B':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: KPSU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h7tb_
  • Heterogens: C5P, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h7tA (A:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    laena
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h7tB (B:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    laena
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h7tB (B:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    l