PDB entry 1h7i

View 1h7i on RCSB PDB site
Description: apolipoprotein e3 22kd fragment lys146gln mutant
Class: lipid binding protein
Keywords: lipid binding protein, lipid transport, heparin-binding, plasma
Deposited on 2001-07-08, released 2001-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein e
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02649
      • engineered mutation (145)
    Domains in SCOPe 2.07: d1h7ia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h7iA (A:)
    kveqavetepepelrqqtewqsgqrwelalgrfwdylrwvqtlseqvqeellssqvtqel
    ralmdetmkelkaykseleeqltpvaeetrarlskelqaaqarlgadmedvcgrlvqyrg
    evqamlgqsteelrvrlashlrklrqrllrdaddlqkrlavyqagaregaerglsairer
    lgplveqgrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h7iA (A:)
    gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
    tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
    klrqrllrdaddlqkrlavy