PDB entry 1h7f

View 1h7f on RCSB PDB site
Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, cmp complex
Class: nucleotidyltransferase
Keywords: nucleotidyltransferase, cmp-kdo synthetase, nucleoside monophosphate glycosides, lipopolysaccharide biosynthesis, sugar-activating enzymes
Deposited on 2001-07-06, released 2001-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.184
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: KPSU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h7fa_
  • Chain 'B':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: KPSU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h7fb_
  • Heterogens: C5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h7fA (A:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    laena
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h7fB (B:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    laena
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h7fB (B:)
    skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
    afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
    pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
    dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
    l