PDB entry 1h7c

View 1h7c on RCSB PDB site
Description: human tubulin chaperone cofactor a
Class: chaperone
Keywords: chaperone, tubulin, protein folding, cofactor a, p14
Deposited on 2001-07-04, released 2002-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tubulin-specific chaperone a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H7C
      • modified residue (24)
      • modified residue (39)
      • modified residue (61-62)
    • Uniprot O75347
    Domains in SCOPe 2.07: d1h7ca_
  • Heterogens: ACY, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h7cA (A:)
    madprvrqikiktgvvrrlvkervmyekeakqqeekiekmraedgenydikkqaeilqes
    rmmipdcqrrleaayldlqrilenekdleeaeeykearlvldsvklea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h7cA (A:)
    prvrqikiktgvvrrlvkervmyekeakqqeekiekmraedgenydikkqaeilqesrmm
    ipdcqrrleaayldlqrilenekdleeaeeykearlvldsvkl